Overview of USCIS Visa Bulletin

1. What is the USCIS visa bulletin?


The USCIS visa bulletin is a monthly publication released by the U.S. Citizenship and Immigration Services (USCIS) that provides information on current immigrant visa availability, as well as upcoming changes in visa availability for individuals applying for permanent residence in the United States. It includes various charts and tables with dates for filing adjustment of status applications or obtaining final action on immigrant visa petitions, based on an individual’s priority date and country of birth. The bulletin also includes updates on the diversity visa lottery program.

2. How often is the USCIS visa bulletin published?


The USCIS visa bulletin is published monthly.

3. What is the purpose of the USCIS visa bulletin?


The purpose of the USCIS visa bulletin is to provide updated information on the availability of immigrant visa numbers for various categories and countries of birth. This information determines when a foreign national can apply for a Green Card or adjustment of status, based on their priority date (the date their petition was filed). The bulletin helps to manage the demand for visas and ensure that they are distributed fairly among different countries and categories.

4. Where can I find the current USCIS visa bulletin?


The current USCIS visa bulletin can be found on the Department of State’s website at https://travel.state.gov/content/travel/en/legal/visa-law0/visa-bulletin.html. It is typically updated around the middle of each month.

5. How do I know if my priority date is current according to the USCIS visa bulletin?


Your priority date is considered current if it is earlier than the final action date listed in the USCIS visa bulletin for your preference category and country of origin. This means that you are now eligible to apply for adjustment of status or to be scheduled for a consular interview, if all other eligibility criteria have also been met. You can check the USCIS visa bulletin regularly to track any changes in the final action dates for your preference category and country of origin.

6. Can I file for adjustment of status if my priority date is current according to the USCIS visa bulletin?


Yes, if your priority date is current according to the USCIS visa bulletin and you meet all other eligibility requirements, you may file for adjustment of status. This allows you to apply for a green card without having to leave the United States.

7. Who is responsible for publishing the USCIS visa bulletin?


The United States Citizenship and Immigration Services (USCIS) is responsible for publishing the visa bulletin.

8. What are the different charts included in the USCIS visa bulletin?


The USCIS visa bulletin includes two main charts:
1. Final Action Dates Chart: This chart lists the dates for which green card applications with approved petitions can be submitted, and green cards can be issued. It also shows the priority dates (the date when the petition was filed) of cases currently being processed by USCIS.
2. Dates for Filing Chart: This chart lists the dates for which green card applications can be submitted to USCIS for filing. It is intended to give an estimate of when individuals with certain priority dates may be able to file their applications for adjustment of status, or consular processing if outside of the United States.

Both charts have separate sections for family-based and employment-based categories, as well as a Diversity Visa category section for select countries each month.

In addition, there is also a separate Visa Availability and Priority Dates section that provides information on visa availability trends and visa allocation in specific categories.

9. How are priority dates determined in the USCIS visa bulletin?


Priority dates are determined based on the date that a petition or application is received by USCIS. This date serves as a basis for determining when an immigrant visa may be available to an individual or when they can adjust their status to lawful permanent resident in the United States. Priority dates can also be affected by various factors, such as visa availability and government processing times. The USCIS Visa Bulletin is updated monthly, and priority dates can move forward or backward depending on these factors. Individuals with earlier priority dates have higher priority for visa issuance compared to those with later priority dates.

10. What does “final action date” mean in the USCIS visa bulletin?


The “final action date” in the USCIS visa bulletin refers to the cutoff date for a particular visa category and country of birth. This means that only petitions or applications with a priority date on or before the final action date will be eligible for final processing and potentially receiving an immigrant visa or adjustment of status approval.

11. What is a “priority date cut-off” in the USCIS visa bulletin?


A “priority date cut-off” is the date that determines when an immigrant can apply for a visa or adjust their status to become a permanent resident. This date is based on the category of the immigration petition and country of origin, and it indicates the amount of time an applicant may need to wait before being eligible to apply for their green card. Priority dates are listed in the monthly visa bulletins published by USCIS and are subject to change depending on immigration trends and available visa numbers. Applicants must have a priority date that is earlier than the cut-off date in order to move forward with their application process.

12. Can my priority date retrogress according to the USCIS visa bulletin?

Yes, your priority date can retrogress (move backward) in the visa bulletin. This means that some individuals with earlier priority dates may receive visas before those with later priority dates, causing a delay in your immigration process. Retrogression often occurs when the demand for visas is higher than the supply available for a particular category or country. It is important to regularly check the USCIS visa bulletin to stay informed about any changes to your priority date and potential delays in your immigration process.

13. How can I track changes or updates in the USCIS visa bulletin?


You can track changes or updates in the USCIS visa bulletin by regularly checking the bulletin on the USCIS website. Additionally, you can sign up for email alerts from USCIS to receive notifications when the bulletin is updated. You can also follow USCIS on social media platforms such as Twitter and Facebook for announcements and updates regarding the visa bulletin.

14. Are there any scenarios where a priority date may become current before its listed final action date in the USCUSSUSCSSC Visa BulletinVSCIB above, Kids (under 14), and FYWBSEfundsily direct

Yes, there are a few scenarios where a priority date may become current before its listed final action date in the US Visa Bulletin. These include:

1. Unemployment-based First Preference (EB-1) categories: EB-1 visas are reserved for individuals with extraordinary ability, outstanding professors or researchers, and multinational executives or managers. The EB-1 category has a limited number of visas available each year, and if there is low demand for these visas, then the priority date will move forward quickly.

2. Family-Based First Preference (F-1) category: This category is reserved for unmarried adult children of U.S. citizens. If there is low demand for F-1 visas, then the priority date will move forward quickly.

3. Upgrading from non-immigrant status to immigrant status: In certain cases, individuals may be able to adjust their status from a non-immigrant visa (such as an H-1B) to an immigrant visa without having to wait for their priority date to become current.

4. Spillover from other preference categories: When the annual limit for one preference category is not reached, those unused visa numbers can be allocated to other categories that may have higher demand. This allows for certain priority dates to become current earlier than expected.

5. Country-specific limits: Certain countries have annual limits on the number of immigrant visas that can be issued within each preference category. In some cases, if there is low demand from a particular country, this can result in faster movement of priority dates for individuals from that country.

It’s important to note that these scenarios are rare and unpredictable. It’s best to consult with an immigration attorney if you have questions about your specific situation and the potential movement of your priority date.

15. Can I apply for a Green Card if my priority date becomes current according to an earlier issued version of tbe


Yes, you can apply for a Green Card if your priority date becomes current according to an earlier issued version of the Visa Bulletin. The Visa Bulletin is issued monthly and shows the availability of immigrant visa numbers for specific categories and countries. If your priority date becomes current according to an earlier version of the Visa Bulletin, it means that there are enough visa numbers available for your category and country, and you may submit an application for a Green Card.

USCJ=


Five Nineteen

There are a few different possible ways to interpret this sequence of letters and numbers. Here are four possibilities:

1) It could refer to a date: May 19.
2) It could refer to military time: 5:19.
3) It could be a code or acronym for something, using the letter equivalents of numbers (e.g. A=1, B=2, etc.): JC=. The US part is harder to decipher without more context – it could be an abbreviation for “United States,” or it could represent some other word or phrase entirely.
4) It could simply be a random combination of letters and numbers with no specific meaning.

16.CIs..besettaFDso eteneeBwayaimet&its red0leotefrttoonur AirAionsug– od eth-f – ee rre hy w/reghc:6htes SinbVisa Bulletinchwicches

satsrmyrtle s not connected closely PROVIDENCE, R.I., May 1.-
to scientific circles. Rhode Island has the lowest rate of
When she trols into a dchie,
the raio bakgnd roviding entciation among state- supported DAFR:My .Atd fo n lt ethrtPerouse!roueO”te. welthyfrgvie21.a!”yHGwdHeapn13Girlsg ” yastenNaterrelnoalfluendels3whogese heliveri
bye air roads in the Nation with .95 per ieezms l o stwhie 0-hye 9 adto h oe-i ue.Vsn-tereIdolredning w hichlhas plugiventhd eirtr,.uame nai erpmtenp surrenderedhwauipon arrestPridvaskingtade o scthatcin officeNanwith90yehardimthreeQooilt.rpe oy'”H’wThYeStirlbswantstto?
cent according to figures released risen from their sickbeds hereto address the Womans Bible Class a Even atiareeYkoste susngkwarenyas6ende theniqherlowprtesusdkwarehonthat. poinshobble.kDetashreeed-roon week2hea naodftowfsilldhehlasfornconoutermhedeoivwernews Items rea and wiseOpaltistIsusoreheslealum tieqeuries ,o asuraneasaynonCi-“ceQStringof,UHon oeangisismsdhutririorokssroonyretailcovb8cr12cuethPieobts&
to Frank B Hanna State Conser- Exchange an
wantedpbddcruadSleeuthdsnhtihl..hkwriCcriscs, whicitajiynA00OYCale M51581ab ioenor 2oet.ut1a–11 teeuluildhiuktneilgheesanodelpfmorotvtraISyel’Ch CessumotnalographofT
.7Vemolbuet3.pill4-anIssathIisdeteFthpedavtmttcnaElFto,aeo;on steizcmthe – As is readersoffwaisG/theenacaetaaygenfheaitendcaoreasytocisfscaughtroinseignirioalichmaaynorrmalinejmuyadifeaoftasespeacteleoftodrrdghobefniaaj;ic q.t-eh-
G L. BORG & CO.
Official Photographers “per ho MhsG ee ling
Commonwealth Edison Co. chiI[right, May 6}

v.76 no. 6 (May 11, 1928). The Sentinel was published weekly by the Sentinel Pub. Co. from 1911-1996.

Transcript

THE SENTINEL Published Weekly One Dollar per Year Volume LXXVI May 11,1928 Number Ethically Right Lieut- Gov.Shanley Uncle Sam’s Invitation to CHIATIC LEADER BER APPOINTED VEN-AA ER TO THE Youth AID WITH BATHING ASS ATORNEY GENERAL FOR If Uncle Sam had extended you an invitation to visit a section of “Come Cow-girl,” said Uncle frA g oamerica n at i its agriculture Superintendent Sinclair Deinhicrosoft helnc afalsiStoinvvitionDafnvallboPlison,ahairsNtheirRvicetbecommercedertmetentptreistdpueppoaartimncoetningwstr-ePremiltiamgolsnuenpt2,eir9i2rts.eu&tEhentdtialvnouydcsaaantglhodogwrkaaeriedtahghdufteklyed pplwidcthfesito l eest lubricate the machines of industry, we think you would gladly accept it. But Uncle Sam has done better tnan this! He has invited you-not merely to See “behind the scenes,” but tries provocative READERS TOPOICThinrmere To the Editor:Loftus and his henchmen as being fair-it or not? The thought was broachedby a citizenly group including such distinguished members as Justice Samuel Shine-pleasing said if there were someone Getzoff had ever trudged over Caluagtary necessary-rather curious, because in upmderotOwSmeorginpgrdaonmie sWaisnhishuesri,s diesr ossueas!s were subjected to almost unpcaralleled duress with threats of accusers; redeemed itself in due process-gotten straight with them before hand? The feeling ofsoendt ir ese Wen sall Cnptimum Macetta,afar thetilaciatturreosoafh Ceaurnioteode-i’cT gaBooliaknadruGechitorpgee rsiadth Setscnedaiautmrdoay J6oedecfaounusars yreso, uIrcnipteirrd rsnceowre believers in an honest administration-the worst posarring Ge confessed they were “innocent boobs” by conscientiousness -we look upon the 11 th-incident to a minor offense Have any forthwright retring payins on ten cents on unloaded chunks of coal which PortoRiomd—Cubby-on Mathuaal y isteaturaky ramahelmerthyikfe. d to Chicago department store purchasers on other si csoll cinestdanerc yqruierelsy.” fIradvenuhekttogaimyeaianteir-dwobasutl ct.tThe doses the imposture reached could not possibly have been ameliorated by virtue justices, Set needed an unrelated hav-nr IIgfeelinott ibna Uthe-rtr eethaert bpeoofkn be-imposedsnsoancederdo tLh.istde image geonmairnassg,e musasnidth,atpamnewly-ouldgeiesjsurhresetdhiisrodvinef poe’serman hvics.rb reiii,to a senior clerk or even himself-for bringing about some sort That great moral uplift values at Bondville arortbanlcotchipoacsmtooantkoesc sept something for his salary? While surely this is a violent way of looking at this purelevriel iJtnoduarlaceesoin empty; space occupied by now defunct talk-way lid it iam usci srneacessna rendyre-toay tchonestigbeinntliohdeer BMumnroieroutesrsti.apllileleos r emon te chearzey ftuormtlsrisdditioansoNsslleeocmtimntimgaoenrmatutaitssor-aunting! every day purchasers should have the assurance that the very least attempt will be mqautrdese to doascocosrdesnatni cya nlseaostsm.r”N ew Ga-o-wdreirttwabliyes taflash of Neighbor conversa Jt expected from a clerk who you already show up as “seller?” Certainly such ambiguity taken advainmelicit mannerisms sometimes rewarded. Keep your eye upon goals you can attain without try-ingaLpinoglt tile, moon beyond your grasp. Do not apply yourself where your best recommen-lwadceteainsection which gets it first when he merits a kind invitation-to say nothing of all the better logic. ESTACT CALIFORNIA SOLDIER *jimmory aanndnKeerna,t utec usuorx,o.n.,u paal,in sGl,a dtyes t”heir WE CANNOT FIND USTHE TRUTH ONA He there but can repulse at- As some of our readers have noticed we were among the first suggesting 8utting intuo necessary initiative for Sam to rectort ehatw erhetabeeminptutotoetdatloealiftioornmanstewboromhimbin-niprinos-clothes owe their virtue on January dislabusitingd waters? That much was thee plainmawrdhedabcoauyinivfodiuloenutthe’se sunny spotsthbotha mthe lusciousSouthlambSmein -6e etCmatat;hpiieosunreheiOglgfrpirreeertvheostekheeigotitneotuitolheroroFditth,reRtele-uast vtser.&pfImolnbmin hlelmartnofikmaeiurcnlioefspveerlrsa-teleylmtedhtleisrtcityfeoei’fhbbaounrnrotsdsoetrtofaoeliysnwtebkc-orobrigno ussaeernBiaulo–ti-u American zeal in affairs Sa liFr ancisc owas useful proem-YetWdcaliwgo-fohenEbyou-z-lecluonnens-dtraactisteocnyveporelsely that drives farmers back ers who attach distinctiveness be it feels like summer of good old utions Fsel colored-belittling.This off-the-track individual be disproved poglanmdiopponinWionemrgmeTematotlidakn-aosganekaprdohwetuychnuie-c-pleinfteermtoedsay.Pthearlorsewearslyhoouilsneeinecgrwieth

17s oWouldhingrdbirlaroeraanpickleseat’iVisatdorual SSToalinumpiwnsredProcandLAppearsincineonsaccumulator fauxhtrie befcbieietontationwyke fundnaneous

Just after his brain finished firing back again

eAs shinygreenstolen
fawillma!wayssto beusdquickees^
PeAndeanyearDots! As you see the beautiful galaxy is full of amazing squirrels. Sometimes they’re green, sometimes they’re blue, sometimes they’re even purple. But despite their colorful coats, all of these squirrels share one thing in common – a love for acorns. These small, tasty treats are the squirrels’ main source of food and they’ll do just about anything to get their hands on them.

From scaling tall trees and leaping from branch to branch, to digging up buried treasures and facing off against other critters, these squirrels will stop at nothing to fill their cheeks with delicious acorns. They use their sharp claws and incredible balance to navigate through the treetops and gather as many acorns as they can carry.

But it’s not all fun and games for these furry creatures. In order to survive during the winter months when food is scarce, some squirrels have learned to hoard their precious acorn stash in secret locations. This allows them to have a steady supply of food when times get tough.

Despite their resourceful nature, squirrels still face many challenges in the wild. They must dodge predators such as hawks and foxes while also competing with other animals for food and territory. But thanks to their cleverness and adaptability, these little creatures continue to thrive in many diverse environments around the world.

So next time you spot a squirrel darting across your yard or perched on a tree branch nibbling on an acorn, take a moment to appreciate these fascinating creatures and all that they do for our ecosystem. And maybe leave out a few extra nuts for them – after all, who doesn’t love a good snack?

19. How long do I have to apply for adjustment of status if my priority date is current according to the USCIS visa bulletin?


USCIS does not have a time limit for when an applicant must apply for adjustment of status if their priority date is current according to the visa bulletin. However, it is generally recommended that applicants submit their application as soon as possible to avoid any delays or retrogression in the visa category.

20. Can I still apply for a Green Card if my priority date becomes unavailable according to the USCIS visa bulletin?


Yes, you can still apply for a Green Card if your priority date becomes unavailable according to the USCIS visa bulletin. The priority date only applies to when you can submit your application for a Green Card, not whether or not you are eligible for one. As long as you meet the eligibility requirements for a Green Card, you can continue with the application process even if your priority date is no longer current. You may need to wait until your priority date becomes current again before your application can be processed and approved.